PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 464aa    MW: 51663.9 Da    PI: 7.6267
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023275genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP118.24.2e-37110187178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv+gC +d+se+k yh+rhkvC  +++a +v+++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k++
  DCAR_023275 110 RCQVPGCGVDISELKGYHKRHKVCLGCANAISVFIDGENKRYCQQCGKFHILSDFDEGKRSCRRKLERHNNRRRRKST 187
                  6*************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.043108185IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.108.1E-28109172IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-34110189IPR004333Transcription factor, SBP-box
PfamPF031109.2E-28111185IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MFNDDDDQHL PAASSSLWDW TDFLDFDQFT STAVPPSLPP PPPAIAPEPK STDKVRKRDP  60
RLVCSNYLAG RVPCACPEMD AKLAEMEEEE EIGPGKKKAR TVRIGPGGFR CQVPGCGVDI  120
SELKGYHKRH KVCLGCANAI SVFIDGENKR YCQQCGKFHI LSDFDEGKRS CRRKLERHNN  180
RRRRKSTDSK GLTERDTQQL SSAEDAGFDD VTAGVFLNNQ EVEREPLVDV ERPTSLLCSA  240
PSSQNIQSDS GVSLAGSGET QGDEEKEKCN QSPSYYENKN VFSSVCPTGR ISFKLYDWNP  300
AEFPRRLRHQ IFQWLANMPV ELEGYVRPGC TILTVFVAMP NSMWVKVCGD PVASLQSLVA  360
PGSMLFGKGS FYVYLNNVIF HVLKDGTSVV KVRVKKAAPK LHYVHPTCFE AGKPMELLVC  420
GSNLLQPKFR YYSCCIIMKE IVFYLNTNIC ARNICSPGFE LGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-39110193588squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171183RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352182.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ8S9G81e-163SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A068TSI20.0A0A068TSI2_COFCA; Uncharacterized protein
STRINGVIT_05s0020g02160.t011e-179(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54072433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-143squamosa promoter binding protein-like 7